Skip to content
Efpeglenatide / Studies
Conjugate · 54,000 Da

Efpeglenatide studies and research data

PepBank has 15 efpeglenatide studies with results. 14 of them gave efpeglenatide, with 91 results, grouped by what the studies measured. In each group, results from studies in people come first. Data as of 2026-10-30.

Searches 91 results and 41 papers. Newer studies from Europe PMC

Results in people
91
100% of 91 results
Results in animals
0
0% of 91 results
Results in lab cells
0
0% of 91 results
From computer models
0
0% of 91 results
The molecule

Efpeglenatide identity

Identifiers, parent molecule, targets and development stage, from curated data.

Efpeglenatide contains an exendin-derived peptide linked through polyethylene glycol to an immunoglobulin Fc carrier. It is a multichain conjugate. It differs from exenatide and dulaglutide.

Kind
Conjugate
Identifiers
ChEMBLCHEMBL4650470 (opens in a new tab)UNII3M1V5Z2270 (opens in a new tab)DrugBankDB15650 (opens in a new tab)CAS1296200-77-51454680-59-1KEGGD11947 (opens in a new tab)
Parent
Analog of Exendin-4The exendin-derived moiety is chemically modified and linked to an Fc carrier through PEG.
Development
Approved in South Korea onlyHanmi PharmaceuticalMFDS records Korean medicinal approval on 2026-10-07. Hanmi developed the product. Approval does not establish authorization in other regions. Source (opens in a new tab)

Targets

Molecular targets with action and evidence source
TargetActionEvidence
GLP1RGLP1RP43220 (opens in a new tab)AgonistGSRS TARGET->AGONIST relationship; KEGG GLP1R target.Source (opens in a new tab)

Sequence and structure

Residues, differences from the parent, calculated properties and 3D structure. Source values and calculated values are shown separately.

Sequence

Sequence not disclosed

Efpeglenatide is a PEG-linked exendin-derived peptide and human IgG4 Fc dimer. GSRS lists two identical 221-position Fc subunits: PSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK. GSRS subunit 3 is HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS, with nominal His1 replaced by imidazoleacetic acid and Ser39 amidated. The systematic name specifies L-residues at chiral sites of the exendin-derived peptide. GSRS disulfides are 1:3-2:3, 1:35-1:95, 1:141-1:199, 2:35-2:95 and 2:141-2:199. Single-chain sequence, termini and numeric disulfide fields remain unfilled because the schema lacks chain identifiers. Length remains null: GSRS has 481 nominal positions including the non-amino-acid cap; KEGG omits that cap from its 38-residue peptide sequence. GSRS reports an estimated average mass of 54000 Da, not an exact mass. Formula remains null: GSRS gives estimated C2398H3677N630O742S17, while KEGG gives C2415H3715N663O743S17(C2H4O)n. PEG length and an exact complete structure are not established.

Parent: Exendin-4

No sequence is listed for the parent, so no alignment is shown.The exendin-derived moiety is chemically modified and linked to an Fc carrier through PEG.

Properties

From identity sources

Molecular weight
54,000 g/mol

Calculated from the sequence

No sequence is listed, so nothing can be calculated.

Net charge by pH

No charge curve

No sequence is listed for this peptide.

Composition

No sequence is listed for this peptide.

3D structure

No 3D structure

No experimental structure (PDB) and no UniProt entry for an AlphaFold model are listed for this peptide. Synthetic peptides often have neither. The sequence view above is the reference.

Results by area

What the studies measured

People first in each area, then animals, then lab cells. Counts are exact and come from studies that gave the peptide.

Trials and papers
Status and safety
Data